Loading...
Statistics
Advertisement

Insurancecomments.com

Advertisement
Conversion Technology Metas Server
Insurancecomments.com is hosted in United States / Houston . Insurancecomments.com uses HTTPS protocol. Number of used technologies: 1. First technologies: Html, Number of used javascripts: 0. Number of used analytics tools: 0. Its server type is: nginx/1.10.0.

Technologies in use by Insurancecomments.com

Technology

Number of occurences: 1
  • Html

Advertisement

Server Type

  • nginx/1.10.0

Conversion rate optimization
visitors Clickable call number Not founded!
visitors Conversion form (contact form, subcriber) Not founded!
visitors Clickable email Not founded!
visitors CTA (call to action) button Not founded!
visitors List Not founded!
visitors Image Not founded!
visitors Enhancement Not founded!
visitors Responsive website Not founded!
visitors Facebook sharing Not founded!
visitors Google+ sharing Not founded!
visitors Twitter sharing Not founded!
visitors Linkedin sharing Not founded!
visitors Blog on the webiste Not founded!

HTTPS (SSL) - Insurancecomments.com

SSL certificate

    • name: /OU=Domain Control Validated/OU=Hosted by HostGator.com, LLC./OU=PositiveSSL Wildcard/CN=*.websitewelcome.com
    • subject:
      • OU:
        • 0: Domain Control Validated
        • 1: Hosted by HostGator.com, LLC.
        • 2: PositiveSSL Wildcard
      • CN: *.websitewelcome.com
    • hash: b86b2c33
    • issuer:
      • C: GB
      • ST: Greater Manchester
      • L: Salford
      • O: COMODO CA Limited
      • CN: COMODO RSA Domain Validation Secure Server CA
    • version: 2
    • serialNumber: 73802823338622261546480845931487065049
    • validFrom: 151016000000Z
    • validTo: 181015235959Z
    • validFrom_time_t: 1444953600
    • validTo_time_t: 1539647999
    • extensions:
      • authorityKeyIdentifier: keyid:90:AF:6A:3A:94:5A:0B:D8:90:EA:12:56:73:DF:43:B4:3A:28:DA:E7
      • subjectKeyIdentifier: 11:37:8F:56:DC:AF:E0:18:CB:07:A7:02:00:3C:DE:8C:B8:11:F4:3A
      • keyUsage: Digital Signature, Key Encipherment
      • basicConstraints: CA:FALSE
      • extendedKeyUsage: TLS Web Server Authentication, TLS Web Client Authentication
      • certificatePolicies: Policy: 1.3.6.1.4.1.6449.1.2.2.7 CPS: https://secure.comodo.com/CPS Policy: 2.23.140.1.2.1
      • crlDistributionPoints: Full Name: URI:http://crl.comodoca.com/COMODORSADomainValidationSecureServerCA.crl
      • authorityInfoAccess: CA Issuers - URI:http://crt.comodoca.com/COMODORSADomainValidationSecureServerCA.crt OCSP - URI:http://ocsp.comodoca.com
      • subjectAltName: DNS:*.websitewelcome.com, DNS:websitewelcome.com

Meta - Insurancecomments.com

Number of occurences: 2
  • Name: robots
    Content: noarchive
  • Name: googlebot
    Content: nosnippet

Server / Hosting

  • IP: 192.185.29.249
  • Latitude: 29.93
  • Longitude: -95.54
  • Country: United States
  • City: Houston

Rname

  • ns10.domaincontrol.com
  • ns09.domaincontrol.com
  • mx.zohomail.com
  • mx2.zohomail.com

Target

  • dns.jomax.net

HTTP Header Response

HTTP/1.1 200 OK Server: nginx/1.10.0 Date: Sun, 08 May 2016 17:31:42 GMT Content-Type: text/html X-Cache: MISS from s_xt40 X-Cache-Lookup: MISS from s_xt40:80 Via: 1.1 s_xt40 (squid/3.5.14) Connection: keep-alive

DNS

host: insurancecomments.com
  1. class: IN
  2. ttl: 1800
  3. type: A
  4. ip: 192.185.29.249
host: insurancecomments.com
  1. class: IN
  2. ttl: 3600
  3. type: NS
  4. target: ns10.domaincontrol.com
host: insurancecomments.com
  1. class: IN
  2. ttl: 3600
  3. type: NS
  4. target: ns09.domaincontrol.com
host: insurancecomments.com
  1. class: IN
  2. ttl: 3600
  3. type: SOA
  4. mname: ns09.domaincontrol.com
  5. rname: dns.jomax.net
  6. serial: 2016050200
  7. refresh: 28800
  8. retry: 7200
  9. expire: 604800
  10. minimum-ttl: 3600
host: insurancecomments.com
  1. class: IN
  2. ttl: 1800
  3. type: MX
  4. pri: 10
  5. target: mx.zohomail.com
host: insurancecomments.com
  1. class: IN
  2. ttl: 1800
  3. type: MX
  4. pri: 20
  5. target: mx2.zohomail.com

Common Typos/Mistakes

This list shows You some spelling mistakes at internet search for this domain.

www.nsurancecomments.com, www.irnsurancecomments.com, www.rnsurancecomments.com, www.ifnsurancecomments.com, www.fnsurancecomments.com, www.ivnsurancecomments.com, www.vnsurancecomments.com, www.iknsurancecomments.com, www.knsurancecomments.com, www.i,nsurancecomments.com, www.,nsurancecomments.com, www.ibnsurancecomments.com, www.bnsurancecomments.com, www.ignsurancecomments.com, www.gnsurancecomments.com, www.itnsurancecomments.com, www.tnsurancecomments.com, www.iynsurancecomments.com, www.ynsurancecomments.com, www.iunsurancecomments.com, www.unsurancecomments.com, www.ijnsurancecomments.com, www.jnsurancecomments.com, www.imnsurancecomments.com, www.mnsurancecomments.com, www.innsurancecomments.com, www.nnsurancecomments.com, www.isurancecomments.com, www.innsurancecomments.com, www.insurancecomments.com, www.inhsurancecomments.com, www.ihsurancecomments.com, www.injsurancecomments.com, www.ijsurancecomments.com, www.inksurancecomments.com, www.iksurancecomments.com, www.inlsurancecomments.com, www.ilsurancecomments.com, www.in surancecomments.com, www.i surancecomments.com, www.inurancecomments.com, www.inseurancecomments.com, www.ineurancecomments.com, www.inswurancecomments.com, www.inwurancecomments.com, www.insdurancecomments.com, www.indurancecomments.com, www.insxurancecomments.com, www.inxurancecomments.com, www.insfurancecomments.com, www.infurancecomments.com, www.insgurancecomments.com, www.ingurancecomments.com, www.insturancecomments.com, www.inturancecomments.com, www.insrancecomments.com, www.insuwrancecomments.com, www.inswrancecomments.com, www.insuerancecomments.com, www.inserancecomments.com, www.insusrancecomments.com, www.inssrancecomments.com, www.insuarancecomments.com, www.insarancecomments.com, www.insuancecomments.com, www.insuriancecomments.com, www.insuiancecomments.com, www.insuroancecomments.com, www.insuoancecomments.com, www.insurlancecomments.com, www.insulancecomments.com, www.insurlancecomments.com, www.insulancecomments.com, www.insur.ancecomments.com, www.insu.ancecomments.com, www.insurncecomments.com, www.insuraoncecomments.com, www.insuroncecomments.com, www.insurapncecomments.com, www.insurpncecomments.com, www.insura9ncecomments.com, www.insur9ncecomments.com, www.insurancecomments.com, www.insurncecomments.com, www.insuraincecomments.com, www.insurincecomments.com, www.insurauncecomments.com, www.insuruncecomments.com, www.insuracecomments.com, www.insuranncecomments.com, www.insurancecomments.com, www.insuranhcecomments.com, www.insurahcecomments.com, www.insuranjcecomments.com, www.insurajcecomments.com, www.insurankcecomments.com, www.insurakcecomments.com, www.insuranlcecomments.com, www.insuralcecomments.com, www.insuran cecomments.com, www.insura cecomments.com, www.insuranecomments.com, www.insurancdecomments.com, www.insurandecomments.com, www.insurancrecomments.com, www.insuranrecomments.com, www.insuranctecomments.com, www.insurantecomments.com, www.insurancvecomments.com, www.insuranvecomments.com, www.insurancfecomments.com, www.insuranfecomments.com, www.insurancgecomments.com, www.insurangecomments.com, www.insuranchecomments.com, www.insuranhecomments.com, www.insurancnecomments.com, www.insurannecomments.com, www.insurancmecomments.com, www.insuranmecomments.com, www.insurancjecomments.com, www.insuranjecomments.com, www.insuranccomments.com, www.insurancexcomments.com, www.insurancxcomments.com, www.insurancescomments.com, www.insurancscomments.com, www.insurancewcomments.com, www.insurancwcomments.com, www.insurancercomments.com, www.insurancrcomments.com, www.insurancefcomments.com, www.insurancfcomments.com, www.insurancevcomments.com, www.insurancvcomments.com, www.insuranceccomments.com, www.insurancccomments.com, www.insuranceqcomments.com, www.insurancqcomments.com, www.insuranceacomments.com, www.insurancacomments.com, www.insuranceycomments.com, www.insurancycomments.com, www.insuranceomments.com, www.insurancecdomments.com, www.insurancedomments.com, www.insurancecromments.com, www.insuranceromments.com, www.insurancectomments.com, www.insurancetomments.com, www.insurancecvomments.com, www.insurancevomments.com, www.insurancecfomments.com, www.insurancefomments.com, www.insurancecgomments.com, www.insurancegomments.com, www.insurancechomments.com, www.insurancehomments.com, www.insurancecnomments.com, www.insurancenomments.com, www.insurancecmomments.com, www.insurancemomments.com, www.insurancecjomments.com, www.insurancejomments.com,

Other websites we recently analyzed

  1. hg57777.com
    hg57777.com
    Las Vegas (United States) - 70.39.84.241
    Server software:
    Technology: CSS, jQuery
    Number of Javascript: 1
    Number of meta tags: 4
  2. William & Brandi sittin' in a tree..
    William & Brandi's Wedding - August 21st Gale Woods Farm
    Culver City (United States) - 205.186.183.161
    Server software: Apache/2.2.22
    Technology: CSS, Google Font API, Html, Iframe, Javascript, Google Analytics, Wordpress
    Number of Javascript: 4
    Number of meta tags: 4
  3. Portail SCPI OPCI : Conseils d’experts pour investir
    Primaliance, le 1er portail dédié aux SCPI de rendement, SCPI fiscales et aux OPCI : toute l’information, les offres et les conseils pour bien investir.
    France - 46.105.42.212
    Server software: Apache/2.2.16 (Debian)
    Technology: DoubleClick.Net, CSS, Fancybox, Font Awesome, Google Font API, Html, Javascript, jQuery Cookie, jQuery Cycle, jQuery Fancybox, Google Analytics, Google AdWords Conversion Tracking, Google Remarketing, Facebook Box, Google +1 Button
    Number of Javascript: 19
    Number of meta tags: 6
  4. familievakantiekleinwalsertal.nl - Home
    Appartement in het Kleinwalsertal. Leuk appartement te huur in het Aparthotel in Kleinwalsertal. Beleef een heerlijke vakantie met het hele gezin. Winter of zomer, er is altijd wat te doen.
    Netherlands - 93.94.226.163
    Server software: Apache
    Technology: CSS, Html, Php
    Number of meta tags: 4
  5. Wix.com wadeswestern created by amandajeffries based on nu-classic-com
    , Home , Lorem ipsum dolor sit amet consectetuer , Lorem ipsum dolor sit amet consectetuer adipiscing elit Suspendisse et dolor vel arcu rhoncus varius Ut massa Praesent vel pede in dui blandit volutpat.Vestib ulum
    Ashburn (United States) - 52.202.41.232
    Server software: Sun-ONE-Web-Server/6.1
    Technology: CSS, Html, Iframe, Javascript, New Relic, Wix, Facebook Box
    Number of Javascript: 4
    Number of meta tags: 6
  6. 网站首页 --- 贵州莲田农业开发有限公司
    贵州莲田农业开发有限公司位于贵州省正安经济开发区，注册资本2000万元，占地3万余平方米，主要是以绿色农业开发。
    Central District (Hong Kong) - 39.109.11.103
    Server software: Microsoft-IIS/7.5
    Technology: CSS, Html, Javascript, Swf Object
    Number of Javascript: 17
    Number of meta tags: 4
  7. Peter Williams Log Home Builder and Hand Crafted & Hand Hewn craftsman in Bemidji Minnesota
    Provo (United States) - 50.87.151.214
    Server software: nginx/1.10.0
    Technology: CSS, Flexslider, Google Font API, Html, Html5, Iframe, Javascript, jQuery, Php, Pingback, Shortcodes, Wordpress, Facebook Box
    Number of Javascript: 23
    Number of meta tags: 7
  8. Need Quick, Affordable Anti-Gazumping Protection? | Anti-Gazumping Agreement UK
    Protect yourself with an anti-gazumping agreement.
    United Kingdom - 164.177.138.124
    Server software: Apache
    Technology: CSS, Html, Javascript, Php
    Number of Javascript: 6
    Number of meta tags: 3
  9. ~´Ã³Â·Â¢dafa888ÓéÀÖ³¡ÏÂÔØ,´ó·¢888ÓéÀÖ³¡ÓÎϷƽ̨¡¿_dafa888ÖÐÎÄÏÂÔØ
    dafa888ÖÐÎÄÏÂÔØ,´ó·¢dafa888ÓéÀÖ³¡ÏÂÔØ´ó·¢888ÓéÀÖ³¡¹Ù·½ÓÎϷƽ̨ÔÚÏßÓéÀÖ³Ç-ÐÅÓþ¸ßÔÚÏßÕæÈ˺ɹټ°ÌåÓýͶעÓéÀֳǡ£ÉèÓÐÕæÇ®¹öÇòͶע¡¢ÌåÓý²©²Ê¡¢ÏÖ½ð°Ù¼ÒÀÖ¡¢ÕæÈË°Ù¼ÒÀÖ¡¢ÊÓƵ°Ù¼ÒÀÖµÈÔÚÏßÏֽ𲩲ÊÓéÀֳǣ¡
    Los Angeles (United States) - 23.89.56.139
    Server software: NetBox Version 2.8 Build 4128
    Technology: CSS, Html, Html5, Iframe, Javascript, Php, Wordpress
    Number of Javascript: 7
    Number of meta tags: 3
  10. power stage - Home
    www.powerstage.ch/ Das Schweizer Motorsport Online-Portal für WRC, ERC, WEC... www.powerstage.ch/ Il portale svizzero dedicato agli sport motoristici come WRC, ERC, Rallies, etc. www.powerstage.ch/ Le site internet suisse dédié aux sport mécaniques comme WRC, ERC, Rallies, etc. www.powerstage.ch/ The Swiss Motorsport Online Website for WRC, ERC, Rallyes and many others...
    Switzerland - 195.190.166.202
    Server software: Apache/2.2.29 (Unix) mod_ssl/2.2.29 OpenSSL/1.0.1e-fips mod_bwlimited/1.4
    Technology: CSS, Html, Javascript, jQuery, Php, Joomla
    Number of Javascript: 6
    Number of meta tags: 5

Check Other Websites